PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015902251.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 545aa    MW: 61197.5 Da    PI: 6.4162
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015902251.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4256.3e-1301755451374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l+e+L++cA+avs++dl +a  l++ l +++s +gdp+qRl ay++e+L+arl +s+s++ykal+++e +   sse l++++++++++P+ +f++
  XP_015902251.1 175 LKEVLIHCARAVSDSDLPAAMDLMELLGHMVSVSGDPIQRLGAYLLEGLRARLEKSGSSIYKALKCEEPT---SSELLSYMSVLYQICPYWRFAY 266
                     5789*****************************************************************9...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     + aN  I eave+e+r+HiiDf+i qG+QW+aL+q La Rp+gpps+RiT v++p+s   +   l+ +ge+L++ Ae+ +vpfef+  +a   ++
  XP_015902251.1 267 VSANVVIKEAVENEQRIHIIDFQIAQGTQWMALIQDLARRPGGPPSIRITCVDDPQSAhaRGGGLRIVGEKLSRHAESWNVPFEFHG-AAMCGSE 360
                     ********************************************************99889999***********************.8999*** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     + le+L+++pgEa++ n+ + lh+++desvs++++rd++L+lvkslsPkv+++veq++++n+++F++rfle+l+yy+a+f+s+++  pr++++ri
  XP_015902251.1 361 VVLETLQIRPGEAIVANFPFVLHHMPDESVSTQNHRDRLLRLVKSLSPKVMTLVEQDSNTNTSPFFARFLETLDYYTAMFESIDVARPRNDKQRI 455
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     + E+++++r+ivn++aceg +r+erhe ++kW+ rl++aGF++ pls +++  +k ll++++++ yrvee++g+l+l Wk+r++ + SaWr
  XP_015902251.1 456 NAEQQCVARDIVNMIACEGPDRVERHELFGKWSVRLRMAGFTQCPLSPSVNVAIKNLLKEYNGN-YRVEEKDGALYLKWKNRAMATSSAWR 545
                     **************************************************************77.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.067149526IPR005202Transcription factor GRAS
PfamPF035142.2E-127175545IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MQTSQKHKGS GVIHGLYHQP VQEIDPYNFS HFQILENNMC PDIGSRGKSV SFETYKEQYF  60
TLESSPATAD FLVCDSPSAV SVLSNRSSFS PQGSQSCLSD PHHSPDIYSG SPVSGCSVAD  120
DANEFKHKLR ELEITLLGPE SDIVDSCYCC YKRESTSTAR WTHSQMVEMI PRLDLKEVLI  180
HCARAVSDSD LPAAMDLMEL LGHMVSVSGD PIQRLGAYLL EGLRARLEKS GSSIYKALKC  240
EEPTSSELLS YMSVLYQICP YWRFAYVSAN VVIKEAVENE QRIHIIDFQI AQGTQWMALI  300
QDLARRPGGP PSIRITCVDD PQSAHARGGG LRIVGEKLSR HAESWNVPFE FHGAAMCGSE  360
VVLETLQIRP GEAIVANFPF VLHHMPDESV STQNHRDRLL RLVKSLSPKV MTLVEQDSNT  420
NTSPFFARFL ETLDYYTAMF ESIDVARPRN DKQRINAEQQ CVARDIVNMI ACEGPDRVER  480
HELFGKWSVR LRMAGFTQCP LSPSVNVAIK NLLKEYNGNY RVEEKDGALY LKWKNRAMAT  540
SSAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-531795458375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015902251.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_015901844.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLW9QX670.0W9QX67_9R
STRINGGLYMA15G12320.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43773360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13